DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10494 and AT3G24490

DIOPT Version :10

Sequence 1:NP_726079.1 Gene:CG10494 / 37453 FlyBaseID:FBgn0034634 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_189092.1 Gene:AT3G24490 / 822039 AraportID:AT3G24490 Length:333 Species:Arabidopsis thaliana


Alignment Length:335 Identity:66/335 - (19%)
Similarity:111/335 - (33%) Gaps:97/335 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DEDEHETEQK-----YAHLMNLGNASHSVSENSSGKASRCK------------WTSAKVETFLEI 58
            ||||.|.|::     |..    ||......:..:...|..:            |...:....||:
plant    41 DEDEVEGEEEDPQGGYIR----GNERFQKRQKPNKVVSGFEFAGPSDAKVAYDWREQEAFVLLEV 101

  Fly    59 IHQLKLQAALRRPRSN------AKVFRMVSREMARRNCPKSPKHLRVKFHQMRRQYARARNGGEP 117
            .....||...|..|:.      .||...:..|.:...|.:....|:.|:.:.:.:..::..|...
plant   102 WGDRFLQLGRRSLRNEDWNEVAEKVSEELRMEKSETQCRRMIDDLKRKYRKEKIKVEKSGLGSSK 166

  Fly   118 FEHFEAVHELMQGEDVSDLD-------------------------EEALESDSDMEADEDQSGMI 157
            :..|..:..|:.....|||.                         :|.::|..|.|.:||:    
plant   167 WSFFNKLDMLLCVSPKSDLGLACGVDSGEFVFMNTKVYLDKSNGFDEMMDSPGDSEEEEDE---- 227

  Fly   158 SETEGDDALDASGSSVNIVARCKWAEGEVDLLLDLIHTLGLRAALLQKRNAKVFKLLSKEMAKRN 222
                 ||.::.....||..|..|       :|.|.:...|           ||::.:.|  :|:.
plant   228 -----DDEVEYERKKVNDAASYK-------MLADSVERFG-----------KVYEKMEK--SKKE 267

  Fly   223 CHKGAEKLRIKFQQLRRLYNKVKNGTGKTFEHFEAMRLVLDPTEEEAAADAEAEAHLSSASDSDF 287
            ..|..||:|..||:...|..|                .::|..:.|.|...|.|.:.....|.|.
plant   268 QMKELEKMRADFQRDLELQKK----------------QIVDRAQSEIARLREEEENHHGGGDDDE 316

  Fly   288 NDSDEEEGDA 297
            ::.:|.|.|:
plant   317 SEDEEMENDS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10494NP_726079.1 Myb_DNA-bind_4 44..123 CDD:463994 15/96 (16%)
Myb_DNA-bind_4 178..257 CDD:463994 16/78 (21%)
Myb_DNA-bind_4 304..391 CDD:463994
AT3G24490NP_189092.1 Myb_DNA-bind_4 90..172 CDD:463994 15/81 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.