DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and Fkbp6

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_030110810.1 Gene:Fkbp6 / 94244 MGIID:2137612 Length:363 Species:Mus musculus


Alignment Length:94 Identity:35/94 - (37%)
Similarity:51/94 - (54%) Gaps:6/94 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GDSLT------MHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTI 102
            ||::|      :.|:|.|:...|.|||:..|..|...:||....:.|.:.|||:|..||..:...
Mouse    84 GDTVTPDASVLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRKGELARFLF 148

  Fly   103 PPQLGYGDQGAGNVIPPKATLLFDVELIN 131
            .|...||..|...:|||.||:||::|||:
Mouse   149 KPAYAYGTLGCPPLIPPNATVLFEIELID 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 33/91 (36%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
Fkbp6XP_030110810.1 FKBP_C 86..176 CDD:365980 31/89 (35%)
TPR_12 254..315 CDD:315987
TPR repeat 254..284 CDD:276809
TPR repeat 289..317 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.