DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and FPR1

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_014264.1 Gene:FPR1 / 855587 SGDID:S000005079 Length:114 Species:Saccharomyces cerevisiae


Alignment Length:91 Identity:51/91 - (56%)
Similarity:66/91 - (72%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQL 106
            |.||.:|:||||||: :|:|||||.||..||...:|.||||||||.|:..:.||||.:||||...
Yeast    24 KTGDLVTIHYTGTLE-NGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPY 87

  Fly   107 GYGDQGAGNVIPPKATLLFDVELINI 132
            .||.:|...:|||.:||:|||||:.:
Yeast    88 AYGPRGFPGLIPPNSTLVFDVELLKV 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 50/87 (57%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
FPR1NP_014264.1 FkpA <1..114 CDD:223619 51/91 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.