DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and FKBP15-2

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_199669.1 Gene:FKBP15-2 / 834915 AraportID:AT5G48580 Length:163 Species:Arabidopsis thaliana


Alignment Length:145 Identity:72/145 - (49%)
Similarity:91/145 - (62%) Gaps:14/145 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKSNLVISCLLLVAISNSLVRAQ----------DLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQ 56
            ||.:|..|..|   |..||:..|          :|::.|...|:.||.::..||::.:||.|.| 
plant     3 SKMSLRYSLFL---IFFSLISLQGFAKKTGDVSELQIGVKFKPKTCEVQAHKGDTIKVHYRGKL- 63

  Fly    57 ADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKA 121
            .||..|||||:|..||.|:||:||||||||||||..||||||||.||.:||||:||:...||..|
plant    64 TDGTVFDSSFERGDPFEFKLGSGQVIKGWDQGLLGACVGEKRKLKIPAKLGYGEQGSPPTIPGGA 128

  Fly   122 TLLFDVELINIGNAP 136
            ||:||.|||.:...|
plant   129 TLIFDTELIAVNEKP 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 57/92 (62%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
FKBP15-2NP_199669.1 FKBP_C 45..137 CDD:395196 57/92 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1907
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I1863
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2725
orthoMCL 1 0.900 - - OOG6_101705
Panther 1 1.100 - - O PTHR45779
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.