DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and FKBP13

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_199380.1 Gene:FKBP13 / 834607 AraportID:AT5G45680 Length:208 Species:Arabidopsis thaliana


Alignment Length:189 Identity:64/189 - (33%)
Similarity:87/189 - (46%) Gaps:71/189 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CLLLVAISNSLVRAQDL----KVEVISTPEV---------------------------------- 36
            |..||  :|||.:|:.:    |.:|.|.||:                                  
plant    20 CRFLV--NNSLNKAEAINLRNKQKVSSDPELSFAQLSSCGRREAIIGFGFSIGLLDNVSALAETT 82

  Fly    37 -CE------------------QKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVI 82
             ||                  .::..|..:..||.|.|: :||.||||::|.:|.||::|.|:||
plant    83 SCEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLE-NGKVFDSSYNRGKPLTFRIGVGEVI 146

  Fly    83 KGWDQGLLN------MCVGEKRKLTIPPQLGYGDQGAG-----NVIPPKATLLFDVELI 130
            ||||||:|.      |..|.||.|.|||:|.|||:|||     .:|||.:.||||:|.|
plant   147 KGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 51/121 (42%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
FKBP13NP_199380.1 FkpA <88..206 CDD:223619 50/119 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45779
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.