DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and AT4G26555

DIOPT Version :10

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_567750.1 Gene:AT4G26555 / 828762 AraportID:AT4G26555 Length:207 Species:Arabidopsis thaliana


Alignment Length:132 Identity:35/132 - (26%)
Similarity:60/132 - (45%) Gaps:30/132 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EVIST---------PEVCE---QKSKNGDSLTMHYTGTLQADGKKFDSSFDR----DQPFTFQLG 77
            |||.|         .|:.|   :::..||.:.::|. ..:|:|....|:.|:    ..|....|.
plant    77 EVIRTLKLPSGVRYQEIIEGEGREAHEGDLVELNYV-CRRANGYFVHSTVDQFSGESSPVKLILD 140

  Fly    78 AGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIP----PKATLL--------FDVELI 130
            ...||:|..:.|:.|..|.||:..|||.:||.::.. ..||    |:.:||        |:::|:
plant   141 ENDVIEGLKEVLVGMKAGGKRRALIPPSVGYINETL-KPIPEEFGPRRSLLSHANEPLVFEIQLL 204

  Fly   131 NI 132
            .:
plant   205 KV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:459735 29/111 (26%)
FRQ1 <142..212 CDD:444056
AT4G26555NP_567750.1 FkpA 88..206 CDD:440311 31/119 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.