DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and AT3G55520

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001327833.1 Gene:AT3G55520 / 824717 AraportID:AT3G55520 Length:190 Species:Arabidopsis thaliana


Alignment Length:154 Identity:51/154 - (33%)
Similarity:72/154 - (46%) Gaps:38/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGA 113
            :||.|.|..|.|.||::.:.:..|:|:||.|.||:.||..|..|.|||..|:|..|:..||..|:
plant    37 VHYEGILAEDEKVFDTTREDNLVFSFELGTGSVIRSWDIALKTMKVGEVAKITCKPEYAYGRAGS 101

  Fly   114 GNVIPPKATLLFDVELI--------NIGNAPPTTNVFKEIDDNADKQLSREEVIVYVSEYLKKQM 170
            ...|||.|||:|:|||:        ::|:                  :|.|...:   |.|||| 
plant   102 PPDIPPDATLIFEVELV
ACRPRKGASVGS------------------VSEERARL---EDLKKQ- 144

  Fly   171 TAVEGQDSEELKNMLAENDKLVEE 194
                    .|:.....|:||...|
plant   145 --------REIAAAAKEDDKKKRE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 37/80 (46%)
EF-hand_7 140..212 CDD:290234 12/55 (22%)
EFh 141..212 CDD:298682 12/54 (22%)
AT3G55520NP_001327833.1 FKBP_C 34..118 CDD:395196 37/80 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.