DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and PAS1

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_566993.1 Gene:PAS1 / 824568 AraportID:AT3G54010 Length:635 Species:Arabidopsis thaliana


Alignment Length:161 Identity:46/161 - (28%)
Similarity:70/161 - (43%) Gaps:19/161 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LTMHYTGTLQADGKK--FDSSFD-RDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGY 108
            |::||.|.|..:.|.  :||..| .|||..|..|.|.|.:|::.....|..||...:|.||...|
plant   294 LSVHYKGMLLNEEKTVFYDSKIDNNDQPLEFSSGEGLVPEGFEMCTRLMLPGEIALVTCPPDYAY 358

  Fly   109 GDQGAGNVIPPKATLLFDVELINIGNAPPTTNV-FKEIDDNADK------QLSRE---EVIVYVS 163
            ........:...|.:.:::||:........|.: |:.|.|.|||      :|.:|   |:.....
plant   359 DKFPRPPGVSEGAHVQWEIELL
GFETPRDWTGLNFQSIMDEADKIRSTGNRLFKEGKFELAKAKY 423

  Fly   164 EYLKKQMTAVEGQDSEE------LKNMLAEN 188
            |.:.::...|..||.:|      .:|||..|
plant   424 EKVLREFNHVNPQDEDEGKIFGDTRNMLHLN 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 26/85 (31%)
EF-hand_7 140..212 CDD:290234 18/65 (28%)
EFh 141..212 CDD:298682 18/64 (28%)
PAS1NP_566993.1 FKBP_C 44..144 CDD:278674
FKBP_C 168..257 CDD:302890
FKBP_C 291..380 CDD:278674 26/85 (31%)
TPR_11 399..480 CDD:290150 15/56 (27%)
TPR repeat 437..478 CDD:276809 6/18 (33%)
TPR_11 451..514 CDD:290150 2/4 (50%)
TPR repeat 483..511 CDD:276809
TPR repeat 516..543 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.