DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and ROF1

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001118695.1 Gene:ROF1 / 822117 AraportID:AT3G25230 Length:562 Species:Arabidopsis thaliana


Alignment Length:149 Identity:65/149 - (43%)
Similarity:83/149 - (55%) Gaps:20/149 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QDLKVEVI------STPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVI 82
            |.||.:::      .|||       |||.:.:|||||| .||.|||||.||..||.|.||.||||
plant    38 QGLKKKLLKEGEGYETPE-------NGDEVEVHYTGTL-LDGTKFDSSRDRATPFKFTLGQGQVI 94

  Fly    83 KGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELI---NIGNAPPTTNVFKE 144
            ||||.|:..|..||....|||.:|.||:.|:...||..|||.|||||:   ::.:......|||:
plant    95 KGWDIGIKTMKKGENAVFTIPAELAYGESGSPPTIPANATLQFDVELLKWDSVKDICKDGGVFKK 159

  Fly   145 I---DDNADKQLSREEVIV 160
            |   .:..:.....:||:|
plant   160 ILAVGEKWENPKDLDEVLV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 51/92 (55%)
EF-hand_7 140..212 CDD:290234 7/24 (29%)
EFh 141..212 CDD:298682 7/23 (30%)
ROF1NP_001118695.1 FKBP_C 50..142 CDD:278674 54/99 (55%)
FKBP_C 283..380 CDD:278674
TPR_11 400..479 CDD:290150
TPR repeat 400..438 CDD:276809
TPR_11 443..514 CDD:290150
TPR repeat 443..478 CDD:276809
TPR_1 483..516 CDD:278916
TPR repeat 483..511 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.