DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and TWD1

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_188801.2 Gene:TWD1 / 821718 AraportID:AT3G21640 Length:365 Species:Arabidopsis thaliana


Alignment Length:191 Identity:45/191 - (23%)
Similarity:82/191 - (42%) Gaps:44/191 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DLKVEVISTPEVCEQKSKNG--------DSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLG---- 77
            |.:.||:. .:|.:|..|.|        .:..:||....:....||:.::...||....||    
plant    41 DSEAEVLD-EKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKK 104

  Fly    78 --AGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNV--IPPKATLLFDVELINIGNAPPT 138
              ||..|     |:.:|..||:..:.:..:|.||.:|..:.  :||.|.||::||:|..      
plant   105 ELAGLAI-----GVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGF------ 158

  Fly   139 TNVFKEIDDNADKQLSREEVIVYVSEYLKKQMTAVEGQDSEELKNMLAENDKLVEEIFQHE 199
                    |...:..:|.::.|      ::::.|.:.:..:  .|.|.:.:||.|.:.|:|
plant   159 --------DETKEGKARSDMTV------EERIGAADRRKMD--GNSLFKEEKLEEAMQQYE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 29/108 (27%)
EF-hand_7 140..212 CDD:290234 11/60 (18%)
EFh 141..212 CDD:298682 11/59 (19%)
TWD1NP_188801.2 FKBP_C 62..156 CDD:395196 26/98 (27%)
PRK15331 196..310 CDD:357168 3/8 (38%)
TPR repeat 230..259 CDD:276809
TPR repeat 264..292 CDD:276809
TPR repeat 298..323 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.