DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and AT3G12340

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_187840.7 Gene:AT3G12340 / 820412 AraportID:AT3G12340 Length:499 Species:Arabidopsis thaliana


Alignment Length:117 Identity:41/117 - (35%)
Similarity:65/117 - (55%) Gaps:7/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ISNSLVRAQDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQ 80
            :||.::      :|.|...::..:.:..|..:::.|||.|:..|..|||:...| |..|:||...
plant   389 LSNGVI------IEDIEKGKLDGKSAVKGKKVSILYTGKLKDTGNLFDSNLGED-PLRFRLGGEN 446

  Fly    81 VIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINI 132
            ||:|...|:..|.||:||:|.|||.|||..:|....:|..|.|:::||.:.|
plant   447 VIEGLSIGVEGMRVGDKRRLIIPPALGYSKRGLKEKVPKSAWLVYEVEAVKI 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 36/92 (39%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
AT3G12340NP_187840.7 NPL 3..96 CDD:407672
FKBP_C 406..494 CDD:395196 34/88 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.