DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and FKBP14

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_060416.1 Gene:FKBP14 / 55033 HGNCID:18625 Length:211 Species:Homo sapiens


Alignment Length:218 Identity:94/218 - (43%)
Similarity:138/218 - (63%) Gaps:15/218 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLVISCLLLVAISNSLVRAQDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSS--FD 67
            |.|:: |.:.::..:|:...::|:||:..|.:|.:|:|.||.:.:||.|.|:.||..|.|:  .:
Human     7 NAVLT-LFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHN 70

  Fly    68 RDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINI 132
            ..||..|.||..:.:|||||||..|||||||||.|||.||||.:|.|. |||::||:|:::|:.|
Human    71 NGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGK-IPPESTLIFNIDLLEI 134

  Fly   133 GNAPPTTNVFKEIDDNADKQLSREEVIVYVSEYLKKQMTAVEGQDSEELKNMLAENDKLVEEIFQ 197
            .|.|.:...|:|:|.|.|.:||::||..|:.:..:|....|..          :.:|.|||:||.
Human   135 RNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNE----------SHHDALVEDIFD 189

  Fly   198 HEDKDKNGFISHDEFSGPKHDEL 220
            .||:||:||||..||: .|||||
Human   190 KEDEDKDGFISAREFT-YKHDEL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 49/94 (52%)
EF-hand_7 140..212 CDD:290234 26/71 (37%)
EFh 141..212 CDD:298682 26/70 (37%)
FKBP14NP_060416.1 FkpA <43..135 CDD:223619 48/92 (52%)
EF-hand_7 141..204 CDD:404394 26/72 (36%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 208..211 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11857
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H23059
Inparanoid 1 1.050 174 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50085
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 1 1.000 - - FOG0008313
OrthoInspector 1 1.000 - - otm41092
orthoMCL 1 0.900 - - OOG6_101705
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2163
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.