DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and FKBP7

DIOPT Version :10

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_851939.1 Gene:FKBP7 / 51661 HGNCID:3723 Length:222 Species:Homo sapiens


Alignment Length:200 Identity:82/200 - (41%)
Similarity:118/200 - (59%) Gaps:13/200 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQ--PFTFQLGAGQVIKGWD 86
            :::|:||:..||.|.:.||.||.|..||.|.|..||.||..|..:::  |..|.||.||||||.|
Human    33 EEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLD 97

  Fly    87 QGLLNMCVGEKRKLTIPPQLGYGDQG-AGNVIPPKATLLFDVELINIGNAPPTTNVFKEIDDNAD 150
            ..:.:||.|||||:.|||...||.:| |...|||.|||:|::||..:...|.:...||:||.:.|
Human    98 IAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDND 162

  Fly   151 KQLSREEVIVYVSEYLKKQMTAVEGQDSEELKNMLAENDKLVEEIFQHEDKDKNGFISHDEFSGP 215
            :|||:.|:.:|:....:|          :|.....:..|.::|:||:..|.|.:||||..|::..
Human   163 RQLSKAEINLYLQREFEK----------DEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVY 217

  Fly   216 KHDEL 220
            :||||
Human   218 QHDEL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:459735 48/95 (51%)
FRQ1 <142..212 CDD:444056 22/69 (32%)
FKBP7NP_851939.1 FKBP_C 46..141 CDD:459735 47/94 (50%)
FRQ1 <127..213 CDD:444056 32/95 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..222 9/21 (43%)
Retention in the endoplasmic reticulum. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 219..222 2/2 (100%)

Return to query results.
Submit another query.