DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and fkbp16

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001373781.1 Gene:fkbp16 / 497400 ZFINID:ZDB-GENE-050208-116 Length:504 Species:Danio rerio


Alignment Length:161 Identity:35/161 - (21%)
Similarity:62/161 - (38%) Gaps:19/161 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GDSLTMHYTGTLQADGKKFDSS-FDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLG 107
            |..:|:...|.|:      |.: .::|....|.:|.|.|.:..::..:.|..||...|....|..
Zfish   207 GQEVTLKMQGVLE------DRTVVEKDSKLVFIIGEGDVTQALEECAITMKKGEIALLLADSQYT 265

  Fly   108 YGDQGAGNVIPPKATLLFDVELINIGN--------APPTTNVFKEIDDNADKQLSREEVIVYVSE 164
            ||..|....||..|.||:.::|::...        .|....:..:..:..:....|||....|..
Zfish   266 YGLLGREPDIPAWAPLLYQLQLL
DFREKPDPLLLPVPDRIRIGNQKRERGNFYFQREEFSKAVQA 330

  Fly   165 Y-LKKQMTAVEGQDSEELKNMLAENDKLVEE 194
            | :...:......|.:   |.:||.::.|.:
Zfish   331 YCMALDVLTTRTNDGQ---NCVAEEEEEVND 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 23/86 (27%)
EF-hand_7 140..212 CDD:290234 10/56 (18%)
EFh 141..212 CDD:298682 10/55 (18%)
fkbp16NP_001373781.1 FKBP_C 203..288 CDD:418595 23/86 (27%)
TPR <305..427 CDD:223533 10/57 (18%)
TPR repeat 312..355 CDD:276809 9/45 (20%)
TPR repeat 360..390 CDD:276809
TPR_19 372..438 CDD:405276
TPR repeat 395..423 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.