DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and Fkbp59

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster


Alignment Length:133 Identity:48/133 - (36%)
Similarity:73/133 - (54%) Gaps:14/133 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLG 107
            :|.::::||||.| .||.:||||..|::||.|.||.|.|||.:|.|:..|.:||:..||..|...
  Fly    31 SGCTVSLHYTGRL-VDGTEFDSSLSRNEPFEFSLGKGNVIKAFDMGVATMKLGERCFLTCAPNYA 94

  Fly   108 YGDQGAGNVIPPKATLLFDVELINIGNAPPTTNVFKEIDDNADKQLSREEVIVYVSEYLKKQMTA 172
            ||..|:...|||.|||:|::|::....        :::..|.|..:.|.     :.|...|:.|.
  Fly    95 YGAAGSPPAIPPDATLIFELEML
GWKG--------EDLSPNQDGSIDRT-----ILEASDKKRTP 146

  Fly   173 VEG 175
            .:|
  Fly   147 SDG 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 41/86 (48%)
EF-hand_7 140..212 CDD:290234 7/36 (19%)
EFh 141..212 CDD:298682 7/35 (20%)
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674 41/86 (48%)
ppisom_GldI <124..233 CDD:132555 7/31 (23%)
BamD 252..>390 CDD:276939
TPR_12 252..329 CDD:290160
TPR repeat 252..280 CDD:276939
TPR repeat 252..280 CDD:276809
TPR repeat 287..326 CDD:276939
TPR repeat 296..326 CDD:276809
TPR_11 299..362 CDD:290150
TPR repeat 329..361 CDD:276939
TPR_1 331..364 CDD:278916
TPR repeat 331..359 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.