DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and shu

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster


Alignment Length:161 Identity:47/161 - (29%)
Similarity:77/161 - (47%) Gaps:15/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQG 88
            :::...:..|..|..:...|...:::.|:|..:.:...||||..|...|.|:.|.|.|::|.:..
  Fly    83 ENIYKRITRTGHVDREAVPNKARVSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVA 147

  Fly    89 LLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELIN---IGNAPPTTNVFKEIDDNAD 150
            :.:|...|:.:..|..:|.:|:.|....|.|||..||.||:|:   ||:|       |.||  |.
  Fly   148 VRSMRPYEQAEFIISYKLLFGELGCPPRIKPKADALFKVEVIDYSLIGDA-------KGID--AI 203

  Fly   151 KQLSREEVIVYVSEYLKKQMTAVEGQDSEEL 181
            .|..|::..|.   |.|.....:.|:||.:|
  Fly   204 PQEDRDKFCVV---YPKAVDLHLHGKDSVKL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 28/92 (30%)
EF-hand_7 140..212 CDD:290234 13/42 (31%)
EFh 141..212 CDD:298682 13/41 (32%)
shuNP_611837.1 FKBP_C 96..189 CDD:278674 28/92 (30%)
TPR repeat 218..257 CDD:276809 4/14 (29%)
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.