Sequence 1: | NP_001246448.1 | Gene: | Fkbp14 / 37449 | FlyBaseID: | FBgn0010470 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001003520.1 | Gene: | fkbp9 / 445126 | ZFINID: | ZDB-GENE-040801-23 | Length: | 564 | Species: | Danio rerio |
Alignment Length: | 213 | Identity: | 75/213 - (35%) |
---|---|---|---|
Similarity: | 115/213 - (53%) | Gaps: | 33/213 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 VEVISTP-EVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLN 91
Fly 92 MCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINIGNAPP-----------TTNVFKEI 145
Fly 146 DDNADKQLSREEVIVYVSEYLKKQMTAVEGQDSEELKNMLA---ENDKLVEEIFQHEDKDKNGFI 207
Fly 208 SHDEF-----SGPKHDEL 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fkbp14 | NP_001246448.1 | FKBP_C | 37..130 | CDD:278674 | 41/92 (45%) |
EF-hand_7 | 140..212 | CDD:290234 | 22/74 (30%) | ||
EFh | 141..212 | CDD:298682 | 22/73 (30%) | ||
fkbp9 | NP_001003520.1 | FKBP_C | 40..132 | CDD:278674 | |
FKBP_C | 152..244 | CDD:278674 | |||
FKBP_C | 264..356 | CDD:278674 | |||
FKBP_C | 375..467 | CDD:278674 | 41/92 (45%) | ||
EF-hand_7 | 488..552 | CDD:290234 | 23/75 (31%) | ||
EFh | 490..551 | CDD:298682 | 22/72 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1507309at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |