DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and fkbp14

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001003471.1 Gene:fkbp14 / 445077 ZFINID:ZDB-GENE-040801-210 Length:211 Species:Danio rerio


Alignment Length:204 Identity:99/204 - (48%)
Similarity:131/204 - (64%) Gaps:26/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQ----PFTFQLGAGQVIKGW 85
            ::|:||:..|.:|.:|||.||.|.:||.|.|:::|..|.||  |.|    |..|.||..:|||||
Zfish    26 EVKIEVLYKPFLCHRKSKYGDILLVHYDGFLESNGTMFHSS--RHQGDKNPVWFTLGIREVIKGW 88

  Fly    86 DQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINIGNAPPTTNVFKEIDDNAD 150
            |:||.|||.||||||||||.|.||.:|.|. |||::||:||:|:|.|.|.|.:...|:|:|.|.|
Zfish    89 DKGLQNMCAGEKRKLTIPPALAYGKEGKGK-IPPESTLIFDIEIIEIRNGPRSHESFQEMDLNDD 152

  Fly   151 KQLSREEVIVYVSEYLKKQMTAVEGQDSEELKNMLAENDK----LVEEIFQHEDKDKNGFISHDE 211
            .:||:.|    |.|||:|:..          |:..|.||.    :||:|||.||:||:||||..|
Zfish   153 WKLSKAE----VKEYLRKEFE----------KHGYAANDTHHEVMVEDIFQKEDEDKDGFISSRE 203

  Fly   212 FSGPKHDEL 220
            |: .:||||
Zfish   204 FT-YQHDEL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 55/96 (57%)
EF-hand_7 140..212 CDD:290234 30/75 (40%)
EFh 141..212 CDD:298682 30/74 (41%)
fkbp14NP_001003471.1 FKBP_C 38..132 CDD:278674 55/96 (57%)
EF-hand_7 141..204 CDD:290234 30/76 (39%)
EFh 142..204 CDD:298682 30/75 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I12028
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H23059
Inparanoid 1 1.050 168 1.000 Inparanoid score I4129
OMA 1 1.010 - - QHG50085
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 1 1.000 - - FOG0008313
OrthoInspector 1 1.000 - - otm24953
orthoMCL 1 0.900 - - OOG6_101705
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2163
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.