DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and fkbp6

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001122145.1 Gene:fkbp6 / 402839 ZFINID:ZDB-GENE-050302-4 Length:343 Species:Danio rerio


Alignment Length:175 Identity:42/175 - (24%)
Similarity:79/175 - (45%) Gaps:37/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGD 110
            |::::::|.::.....|:::.....|...:||....:.|.:.|||.|..||..:....|:..|||
Zfish    62 SVSINFSGFIEYTDAPFETTNHLKYPRMMKLGKDVTLYGLELGLLTMKKGEFSRFLFKPKYAYGD 126

  Fly   111 QGAGNVIPPKATLLFDVELINIGNAPPTTNVFKEIDDNADKQLSRE-----EVIVYV-------- 162
            .|....|||.||:|::|::::..::       .::||..|..|..:     .|::.|        
Zfish   127 LGCPPHIPPCATVLYEVQVLDFLDS-------AQVDDFMDLTLEEQNTAPLSVLLNVLDTQRSFG 184

  Fly   163 ------------SEYLKKQMTAVEGQDSEELKNMLAENDKLVEEI 195
                        .|..|:.||.::.::.|:     ||..|.:|||
Zfish   185 NLCFNKKRYEDARERYKQAMTLLQNREPED-----AEEKKHLEEI 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 25/83 (30%)
EF-hand_7 140..212 CDD:290234 17/81 (21%)
EFh 141..212 CDD:298682 17/80 (21%)
fkbp6NP_001122145.1 FKBP_C 63..146 CDD:278674 24/82 (29%)
TPR_12 174..258 CDD:290160 12/56 (21%)
TPR repeat 214..255 CDD:276809 6/16 (38%)
TPR_11 228..291 CDD:290150
TPR repeat 260..286 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.