DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and Fkbp12

DIOPT Version :10

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster


Alignment Length:91 Identity:49/91 - (53%)
Similarity:65/91 - (71%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQL 106
            |||..:|:||||||. ||.|||||.||::||.|.:|.|:||:|||:|:..:.||::.||...|..
  Fly    18 KNGQKVTVHYTGTLD-DGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDY 81

  Fly   107 GYGDQGAGNVIPPKATLLFDVELINI 132
            .||.:|...||||.:||.|||||:.:
  Fly    82 AYGSRGHPGVIPPNSTLTFDVELLKV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:459735 48/87 (55%)
FRQ1 <142..212 CDD:444056
Fkbp12NP_523792.2 FkpA 3..107 CDD:440311 49/89 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.