DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and fkbp5

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_005166078.1 Gene:fkbp5 / 368924 ZFINID:ZDB-GENE-030616-630 Length:477 Species:Danio rerio


Alignment Length:88 Identity:42/88 - (47%)
Similarity:57/88 - (64%) Gaps:1/88 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGY 108
            ||.:.:||||.| ..|||||||.||.:||.|.:|.|||||.||..:.:|..||...:...|:..|
Zfish    74 GDRVFVHYTGRL-LSGKKFDSSLDRKEPFVFNVGKGQVIKAWDICVCSMQKGEVCLMLCKPEYAY 137

  Fly   109 GDQGAGNVIPPKATLLFDVELIN 131
            |..|:...:||.:||:|::||:|
Zfish   138 GSAGSPPKVPPNSTLVFEIELLN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 40/85 (47%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
fkbp5XP_005166078.1 FKBP_C 69..159 CDD:278674 40/85 (47%)
FkpA <167..271 CDD:223619
TPR_11 291..372 CDD:290150
TPR repeat 292..320 CDD:276809
TPR repeat 340..370 CDD:276809
TPR_11 343..405 CDD:290150
TPR 343..374 CDD:197478
TPR repeat 375..403 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.