DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and Fkbp14

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001013228.1 Gene:Fkbp14 / 362366 RGDID:1311705 Length:211 Species:Rattus norvegicus


Alignment Length:212 Identity:95/212 - (44%)
Similarity:134/212 - (63%) Gaps:14/212 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLVAISNSLVRAQDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSS--FDRDQPFT 73
            |.:..:|.:|:...::|:||:..|.:|.:|:|.||.:.:||.|.|:.||..|.|:  .:..||..
  Rat    12 LWVTVLSGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPVW 76

  Fly    74 FQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINIGNAPPT 138
            |.||..:|:|||||||..|||||||||||||.||||.:|.|. |||::||:|:::|:.|.|.|.:
  Rat    77 FTLGILEVLKGWDQGLKGMCVGEKRKLTIPPALGYGKEGKGK-IPPESTLIFNIDLLEIRNGPRS 140

  Fly   139 TNVFKEIDDNADKQLSREEVIVYVSEYLKKQMTAVEGQDSEELKNMLAENDKLVEEIFQHEDKDK 203
            ...|:|:|.|.|.:||:.||.||:....:|....|..          :.:|.|||:||..||:||
  Rat   141 HESFQEMDLNDDWKLSKHEVKVYLQNEFEKHGAVVNE----------SHHDALVEDIFDKEDEDK 195

  Fly   204 NGFISHDEFSGPKHDEL 220
            :||||..||: ..||||
  Rat   196 DGFISAREFT-YVHDEL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 51/94 (54%)
EF-hand_7 140..212 CDD:290234 27/71 (38%)
EFh 141..212 CDD:298682 27/70 (39%)
Fkbp14NP_001013228.1 FKBP_C 38..132 CDD:395196 52/95 (55%)
EF-hand_7 141..204 CDD:404394 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11370
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H23059
Inparanoid 1 1.050 176 1.000 Inparanoid score I3940
OMA 1 1.010 - - QHG50085
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 1 1.000 - - FOG0008313
OrthoInspector 1 1.000 - - otm45231
orthoMCL 1 0.900 - - OOG6_101705
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2163
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.