Sequence 1: | NP_001246448.1 | Gene: | Fkbp14 / 37449 | FlyBaseID: | FBgn0010470 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038942330.1 | Gene: | Fkbp10 / 360627 | RGDID: | 1549751 | Length: | 620 | Species: | Rattus norvegicus |
Alignment Length: | 202 | Identity: | 71/202 - (35%) |
---|---|---|---|
Similarity: | 110/202 - (54%) | Gaps: | 33/202 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 PEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKR 98
Fly 99 KLTIPPQLGYGDQGAGNVIPPKATLLFDVELIN-----------IGNAPPTTNVFKEIDDNADKQ 152
Fly 153 LSREEVIVYVSEYLKKQMT-----AVEGQDSEELKNMLAENDKLVEEIFQHEDKDKNGFISHDEF 212
Fly 213 SGPKHDE 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fkbp14 | NP_001246448.1 | FKBP_C | 37..130 | CDD:278674 | 43/92 (47%) |
EF-hand_7 | 140..212 | CDD:290234 | 19/76 (25%) | ||
EFh | 141..212 | CDD:298682 | 19/75 (25%) | ||
Fkbp10 | XP_038942330.1 | FKBP_C | 54..146 | CDD:395196 | |
FKBP_C | 166..297 | CDD:395196 | |||
FKBP_C | 317..409 | CDD:395196 | |||
FKBP_C | 430..521 | CDD:395196 | 43/92 (47%) | ||
EFh | 544..605 | CDD:238008 | 19/74 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1507309at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |