DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and Fkbp10

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_038942330.1 Gene:Fkbp10 / 360627 RGDID:1549751 Length:620 Species:Rattus norvegicus


Alignment Length:202 Identity:71/202 - (35%)
Similarity:110/202 - (54%) Gaps:33/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKR 98
            ||.|.:.:|.||.:..||..:| .||.:..||.|.:.|....|||.:||:|.|:||..|||||:|
  Rat   427 PESCNETAKIGDFIRYHYNCSL-LDGTRLFSSHDYEAPQEITLGANKVIEGLDRGLQGMCVGERR 490

  Fly    99 KLTIPPQLGYGDQGAGNVIPPKATLLFDVELIN-----------IGNAPPTTNVFKEIDDNADKQ 152
            :|.:||.|.:|:.||..| |..|.|||:||||:           :....|..::|:::|.|.|.:
  Rat   491 QLIVPPHLAHGENGARGV-PGSAVLLFEVELISREDGLPAGYLFVWYQDPPASLFEDMDLNKDGE 554

  Fly   153 LSREEVIVYVSEYLKKQMT-----AVEGQDSEELKNMLAENDKLVEEIFQHEDKDKNGFISHDEF 212
            :..||    .|.::|.|:.     .:.|||.          ||.:.::||::|::::|.|:.:|.
  Rat   555 VPPEE----FSSFIKAQVNEGKGRLMPGQDP----------DKTISDMFQNQDRNQDGKITAEEL 605

  Fly   213 SGPKHDE 219
            . .|.||
  Rat   606 K-LKSDE 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 43/92 (47%)
EF-hand_7 140..212 CDD:290234 19/76 (25%)
EFh 141..212 CDD:298682 19/75 (25%)
Fkbp10XP_038942330.1 FKBP_C 54..146 CDD:395196
FKBP_C 166..297 CDD:395196
FKBP_C 317..409 CDD:395196
FKBP_C 430..521 CDD:395196 43/92 (47%)
EFh 544..605 CDD:238008 19/74 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.