DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and Fkbp15

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_006538097.1 Gene:Fkbp15 / 338355 MGIID:2444782 Length:1255 Species:Mus musculus


Alignment Length:209 Identity:56/209 - (26%)
Similarity:91/209 - (43%) Gaps:42/209 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKSNLVISCLLLVAISNSLVRAQDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQAD---GKKF 62
            ::|.|.:.|  |...:...||.|:...||             .||||.:.|||.|..:   |:.|
Mouse   168 VAKCNSISS--LDAVLCQDLVAAEGPAVE-------------TGDSLEVAYTGWLLQNHVLGQVF 217

  Fly    63 DSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGA-GNVIPPKATLLFD 126
            ||:.::|:|...:||:|:|:||.:.|||.|..|.||.:..|.....|.:|. |...|..:.|:|:
Mouse   218 DSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGVIGWTQPTDSILVFE 282

  Fly   127 VELINI---------GNAPPTTNVFKEIDDNADKQLSREEVIVYV--------------SEYLKK 168
            ||:..:         |::..:.:........|...||.:.|:..:              |..|.:
Mouse   283 VEVRRVKFARDSGSDGHSVSSRDSAAPSPIPASDSLSADPVVTPLPLPLKPGEPGLRSKSNSLSE 347

  Fly   169 QMTAVEGQDSEELK 182
            |:|.....|:.:.|
Mouse   348 QLTVNSNPDTVKAK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 36/96 (38%)
EF-hand_7 140..212 CDD:290234 10/57 (18%)
EFh 141..212 CDD:298682 10/56 (18%)
Fkbp15XP_006538097.1 FKBP_C 192..285 CDD:365980 37/105 (35%)
PRK10263 <378..>489 CDD:236669
Smc <561..890 CDD:224117
PHA03247 <944..1129 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.