DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and Fkbp7

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001099955.2 Gene:Fkbp7 / 295672 RGDID:1305293 Length:218 Species:Rattus norvegicus


Alignment Length:200 Identity:83/200 - (41%)
Similarity:120/200 - (60%) Gaps:13/200 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQ--PFTFQLGAGQVIKGWD 86
            :::|:||:..||.|.:.|:.||.|..||.|.|..||.||..|..:|:  |..|.||.|.||||.|
  Rat    29 EEVKIEVLHRPENCSKTSRKGDLLNAHYDGYLAKDGSKFYCSRTQDEGHPKWFVLGVGHVIKGLD 93

  Fly    87 QGLLNMCVGEKRKLTIPPQLGYGDQG-AGNVIPPKATLLFDVELINIGNAPPTTNVFKEIDDNAD 150
            ..:::||.|||||:.|||.|.||.:| |...|||.|||:|::||..:...|.:...||:||.:.|
  Rat    94 IAMMDMCPGEKRKVIIPPSLAYGKEGYAEGKIPPNATLMFEIELYAVTKGPRSIETFKQIDTDND 158

  Fly   151 KQLSREEVIVYVSEYLKKQMTAVEGQDSEELKNMLAENDKLVEEIFQHEDKDKNGFISHDEFSGP 215
            :|||:.|:.:|:.:..:|.   .:.:|....|.:|       |:||:..|.|.:||||..|::..
  Rat   159 RQLSKAEIELYLQKDFEKD---AKPRDKSYQKAVL-------EDIFKKNDHDGDGFISPKEYNVH 213

  Fly   216 KHDEL 220
            :||||
  Rat   214 QHDEL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 48/95 (51%)
EF-hand_7 140..212 CDD:290234 23/71 (32%)
EFh 141..212 CDD:298682 23/70 (33%)
Fkbp7NP_001099955.2 FKBP_C 42..137 CDD:278674 47/94 (50%)
EF-hand_7 148..210 CDD:290234 23/71 (32%)
EFh 148..209 CDD:298682 23/70 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11370
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 176 1.000 Inparanoid score I3940
OMA 1 1.010 - - QHG50085
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45231
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2163
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.