DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and Fkbp2

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001127900.1 Gene:Fkbp2 / 293702 RGDID:1560660 Length:140 Species:Rattus norvegicus


Alignment Length:123 Identity:66/123 - (53%)
Similarity:83/123 - (67%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CLLLVAISNSLVRAQDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTF 74
            ||..:..:......:.|::.|....:.|..||:.||.|.|||||.|: ||.:||||..::|||.|
  Rat    13 CLSALVTATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLE-DGTEFDSSLPQNQPFVF 76

  Fly    75 QLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINI 132
            .||.||||||||||||.||.||||||.||.:||||::||...||..|||:|:|||:.|
  Rat    77 SLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKI 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 60/92 (65%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
Fkbp2NP_001127900.1 FKBP_C 40..132 CDD:395196 60/92 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5480
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101705
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.