DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and SPAC27F1.06c

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_594535.1 Gene:SPAC27F1.06c / 2541479 PomBaseID:SPAC27F1.06c Length:362 Species:Schizosaccharomyces pombe


Alignment Length:147 Identity:49/147 - (33%)
Similarity:71/147 - (48%) Gaps:32/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VAISNSLVRAQDLKVEVISTPEVCEQKSKN--------------------GDS--------LTMH 50
            |.:|:| |..:..|.|.....|..|:|||:                    ||.        ::|.
pombe   219 VDVSDS-VNGKKRKTEPAGEGEQTEKKSKSTKTYPKQVLEGNVTVQDKVKGDGPAAKRKKRVSMR 282

  Fly    51 YTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGN 115
            |.|.| .:||.||.:. ..:||||.||..:||||||.|::.|.||.:|.:.||..:.||.:....
pombe   283 YIGRL-TNGKVFDKNI-TGKPFTFNLGLEEVIKGWDVGIVGMQVGGERTIHIPAAMAYGSKRLPG 345

  Fly   116 VIPPKATLLFDVELINI 132
             ||..:.|:|||:|:.:
pombe   346 -IPANSDLVFDVKLLAV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 41/120 (34%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
SPAC27F1.06cNP_594535.1 FkpA 152..362 CDD:223619 49/147 (33%)
FKBP_C 272..359 CDD:278674 35/89 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.