DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and fkbp39

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_596694.1 Gene:fkbp39 / 2539812 PomBaseID:SPBC1347.02 Length:361 Species:Schizosaccharomyces pombe


Alignment Length:90 Identity:39/90 - (43%)
Similarity:58/90 - (64%) Gaps:3/90 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLG 107
            ||..:.|.|.|.|: :||.||.: .:.:||.|.||.|:||:|||.|:..|..|.:||:|||..:.
pombe   274 NGKKVEMRYIGKLE-NGKVFDKN-TKGKPFAFILGRGEVIRGWDVGVAGMQEGGERKITIPAPMA 336

  Fly   108 YGDQGAGNVIPPKATLLFDVELINI 132
            ||:|.... ||..:||:|:|:|:.:
pombe   337 YGNQSIPG-IPKNSTLVFEVKLVRV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 38/86 (44%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
fkbp39NP_596694.1 FkpA <201..361 CDD:223619 39/90 (43%)
FKBP_C 272..358 CDD:278674 38/86 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.