DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Fkbp14 and FKBP8

DIOPT Version :9

Sequence 1:	NP_001246448.1	Gene:	Fkbp14 / 37449	FlyBaseID:	FBgn0010470	Length:	220	Species:	Drosophila melanogaster
Sequence 2:	NP_036313.3	Gene:	FKBP8 / 23770	HGNCID:	3724	Length:	413	Species:	Homo sapiens

Alignment Length:	123	Identity:	35/123 - (28%)
Similarity:	57/123 - (46%)	Gaps:	13/123 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    16 ISNSLVRAQDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQP-FTFQLGAG 79
            :.|.|:|    |..::..|....:..| |..:|:|...:|: :|.:.     :::| ..|.||..
Human    97 LGNGLLR----KKTLVPGPPGSSRPVK-GQVVTVHLQTSLE-NGTRV-----QEEPELVFTLGDC 150

  Fly    80 QVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGN-VIPPKATLLFDVELINIGNAP 136
            .||:..|..:..|.|||...:|...:..||.||:.: .|||.|.|..:|.|....:.|
Human   151 DVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDGP 208

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Fkbp14	NP_001246448.1	FKBP_C	37..130	CDD:278674	28/94 (30%)
		EF-hand_7	140..212	CDD:290234
		EFh	141..212	CDD:298682
FKBP8	NP_036313.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..68
		FKBP_C	113..202	CDD:278674	28/95 (29%)
		TPR_11	222..304	CDD:290150
		TPR 1	222..255
		TPR repeat	231..267	CDD:276809
		TPR repeat	272..302	CDD:276809
		TPR 2	273..306
		TPR_11	274..338	CDD:290150
		TPR 3	307..340
		TPR	307..340	CDD:197478
		TPR repeat	307..335	CDD:276809
		TPR repeat	341..369	CDD:276809
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0545
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900