DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and Fkbp14

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_705801.1 Gene:Fkbp14 / 231997 MGIID:2387639 Length:211 Species:Mus musculus


Alignment Length:215 Identity:95/215 - (44%)
Similarity:136/215 - (63%) Gaps:14/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISCLLLVAISNSLVRAQDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSS--FDRDQ 70
            |..|.:..:|.:|:...::|:||:..|.:|.:|:|.||.:.:||.|.|:.||..|.|:  .:..|
Mouse     9 ILALWVTVLSGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQ 73

  Fly    71 PFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINIGNA 135
            |..|.||..:|:|||||||..||||||||||:||.||||.:|.|. |||::||:|:::|:.|.|.
Mouse    74 PVWFTLGILEVLKGWDQGLKGMCVGEKRKLTVPPALGYGKEGKGK-IPPESTLIFNIDLLEIRNG 137

  Fly   136 PPTTNVFKEIDDNADKQLSREEVIVYVSEYLKKQMTAVEGQDSEELKNMLAENDKLVEEIFQHED 200
            |.:...|:|:|.|.|.:||:.||.||:.:..:|....|..          :.:|.|||:||..||
Mouse   138 PRSHESFQEMDLNDDWRLSKHEVKVYLQKEFEKHGAVVNE----------SHHDALVEDIFDKED 192

  Fly   201 KDKNGFISHDEFSGPKHDEL 220
            :||:||||..||: ..||||
Mouse   193 EDKDGFISAREFT-YVHDEL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 50/94 (53%)
EF-hand_7 140..212 CDD:290234 27/71 (38%)
EFh 141..212 CDD:298682 27/70 (39%)
Fkbp14NP_705801.1 FKBP_C 38..132 CDD:278674 51/95 (54%)
EF-hand_7 141..204 CDD:290234 21/62 (34%)
EFh 142..204 CDD:298682 21/61 (34%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 208..211 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11605
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H23059
Inparanoid 1 1.050 177 1.000 Inparanoid score I4022
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50085
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 1 1.000 - - FOG0008313
OrthoInspector 1 1.000 - - otm43162
orthoMCL 1 0.900 - - OOG6_101705
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2163
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.