DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Fkbp14 and FKBP5

DIOPT Version :9

Sequence 1:	NP_001246448.1	Gene:	Fkbp14 / 37449	FlyBaseID:	FBgn0010470	Length:	220	Species:	Drosophila melanogaster
Sequence 2:	NP_001139247.1	Gene:	FKBP5 / 2289	HGNCID:	3721	Length:	457	Species:	Homo sapiens

Alignment Length:	94	Identity:	45/94 - (47%)
Similarity:	59/94 - (62%)	Gaps:	1/94 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    38 EQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTI 102
            |:....||.:.:||.|.| ::|||||||.||::||.|.||.|||||.||.|:..|..||...|..
Human    44 EETPMIGDKVYVHYKGKL-SNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLC 107

  Fly   103 PPQLGYGDQGAGNVIPPKATLLFDVELIN 131
            .|:..||..|:...||..|||.|::||::
Human   108 KPEYAYGSAGSLPKIPSNATLFFEIELLD 136

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Fkbp14	NP_001246448.1	FKBP_C	37..130	CDD:278674	44/91 (48%)
		EF-hand_7	140..212	CDD:290234
		EFh	141..212	CDD:298682
FKBP5	NP_001139247.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..24
		FKBP_C	43..135	CDD:278674	44/91 (48%)
		TPR_11	267..347	CDD:290150
		TPR 1	268..301
		TPR repeat	268..296	CDD:276809
		TPR 2	317..350
		TPR_11	319..382	CDD:290150
		TPR	319..350	CDD:197478
		TPR repeat	319..345	CDD:276809
		TPR repeat	350..380	CDD:276809
		TPR 3	351..384
		TPR_1	352..384	CDD:278916
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	420..457
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0545
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
User_Submission	0	0.000	Not matched by this tool.
	3	2.770