DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and FKBP2

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001357294.1 Gene:FKBP2 / 2286 HGNCID:3718 Length:171 Species:Homo sapiens


Alignment Length:123 Identity:68/123 - (55%)
Similarity:84/123 - (68%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CLLLVAISNSLVRAQDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTF 74
            ||..||.:......:.|::.|....:.|..||:.||.|.|||||.|: ||.:||||..::|||.|
Human    44 CLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLE-DGTEFDSSLPQNQPFVF 107

  Fly    75 QLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELINI 132
            .||.||||||||||||.||.||||||.||.:||||::||...||..|||:|:|||:.|
Human   108 SLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 60/92 (65%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
FKBP2NP_001357294.1 FKBP_C 71..163 CDD:333962 60/92 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5629
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101705
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.