DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and fkb-1

DIOPT Version :10

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001255531.1 Gene:fkb-1 / 191634 WormBaseID:WBGene00001426 Length:139 Species:Caenorhabditis elegans


Alignment Length:132 Identity:72/132 - (54%)
Similarity:90/132 - (68%) Gaps:3/132 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KSNLVIS--CLLLVAISNSLVRAQDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSS 65
            |:.:::.  |||.:|.:....:...|::.|....|.|.|||:.||.|.||||||| .||.:||||
 Worm     2 KTAVIVGLLCLLAIAYAADEQKIDKLQIGVKKRAENCVQKSRKGDQLHMHYTGTL-LDGTEFDSS 65

  Fly    66 FDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELI 130
            ..|::.|||.||.|.||||||||||||||||:|.|||||.||||::||...||..:.|.|||||:
 Worm    66 RTRNEEFTFTLGQGNVIKGWDQGLLNMCVGERRILTIPPHLGYGERGAPPKIPGNSVLKFDVELM 130

  Fly   131 NI 132
            .|
 Worm   131 KI 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:459735 62/92 (67%)
FRQ1 <142..212 CDD:444056
fkb-1NP_001255531.1 FKBP_C 38..129 CDD:459735 61/91 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.