DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and fkb-6

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_508026.1 Gene:fkb-6 / 180371 WormBaseID:WBGene00001431 Length:431 Species:Caenorhabditis elegans


Alignment Length:185 Identity:61/185 - (32%)
Similarity:87/185 - (47%) Gaps:33/185 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPP 104
            |...|.::.:||.|||: :|.|||||.||...|:|.||.|.||||||.|:..|..||..:.||..
 Worm    29 KPTTGTTVKVHYVGTLE-NGTKFDSSRDRGDQFSFNLGRGNVIKGWDLGVATMTKGEVAEFTIRS 92

  Fly   105 QLGYGDQGAGNVIPPKATLLFDVELINIGNAPPTTNVFKEIDDNADKQLSR-------------- 155
            ..||||.|:...||..|||:|:|||....        .::|..:.|..:.|              
 Worm    93 DYGYGDAGSPPKIPGGATLIFEVEL
FEWS--------AEDISPDRDGTILRTIIVEGSKNSFPND 149

  Fly   156 -EEVIVYV------SEYLKKQMTAVEGQDSEELKNMLAENDKLVEEIFQHEDKDK 203
             .:|:.:.      :|:..:::....|:.|||   .|.|..:.....||..:|.|
 Worm   150 TSKVLAHCVGTYQGTEFYNREVNFHIGEGSEE---GLPEGVERALRRFQLGEKSK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 45/89 (51%)
EF-hand_7 140..212 CDD:290234 15/85 (18%)
EFh 141..212 CDD:298682 15/84 (18%)
fkb-6NP_508026.1 FKBP_C 26..117 CDD:278674 44/88 (50%)
TPR_11 254..334 CDD:290150
TPR repeat 254..282 CDD:276809
TPR repeat 291..332 CDD:276809
TPR_11 305..368 CDD:290150
TPR_1 337..370 CDD:278916
TPR repeat 337..365 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.