DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp14 and fkb-3

DIOPT Version :9

Sequence 1:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001379619.1 Gene:fkb-3 / 179113 WormBaseID:WBGene00001428 Length:261 Species:Caenorhabditis elegans


Alignment Length:107 Identity:50/107 - (46%)
Similarity:68/107 - (63%) Gaps:3/107 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DLKVEVISTPEV--CEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQ 87
            |..|.:..|.||  |.:|::.||:|...||..|: ||...|||:.|::||.|::|:||||||.|.
 Worm   145 DEGVHIHITHEVEGCTEKAQAGDTLHQQYTLNLE-DGSFIDSSWSRNRPFIFKMGSGQVIKGMDI 208

  Fly    88 GLLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVEL 129
            .:..||.|||||:.|||:|.||:.|....||..:.|.||:.|
 Worm   209 AMEGMCQGEKRKVVIPPELAYGENGRPPAIPGNSYLHFDLSL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 45/93 (48%)
EF-hand_7 140..212 CDD:290234
EFh 141..212 CDD:298682
fkb-3NP_001379619.1 FkpA 55..250 CDD:223619 49/105 (47%)
FKBP_C 159..250 CDD:395196 44/91 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.