Sequence 1: | NP_001246448.1 | Gene: | Fkbp14 / 37449 | FlyBaseID: | FBgn0010470 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492792.1 | Gene: | fkb-7 / 172963 | WormBaseID: | WBGene00001432 | Length: | 318 | Species: | Caenorhabditis elegans |
Alignment Length: | 254 | Identity: | 67/254 - (26%) |
---|---|---|---|
Similarity: | 108/254 - (42%) | Gaps: | 67/254 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 DLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGL 89
Fly 90 LNMCVGEKRKLTIPPQLGYGDQGA--GNVIPPKATLLFDVELINIGNAPPTTNV-FKEIDDNADK 151
Fly 152 QLSREEVIVYVSEYLKKQMTAVEGQ--DSEELKNMLAE--------------------------- 187
Fly 188 ----NDKLVEEIFQHEDK--------DKNGFISH-------DEF-SGP------KHDEL 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fkbp14 | NP_001246448.1 | FKBP_C | 37..130 | CDD:278674 | 30/94 (32%) |
EF-hand_7 | 140..212 | CDD:290234 | 24/120 (20%) | ||
EFh | 141..212 | CDD:298682 | 24/119 (20%) | ||
fkb-7 | NP_492792.1 | FKBP_C | 86..179 | CDD:278674 | 30/94 (32%) |
EFh | 190..256 | CDD:298682 | 15/70 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
3 | 2.770 |