DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Fkbp14 and Fkbp5

DIOPT Version :9

Sequence 1:	NP_001246448.1	Gene:	Fkbp14 / 37449	FlyBaseID:	FBgn0010470	Length:	220	Species:	Drosophila melanogaster
Sequence 2:	NP_034350.1	Gene:	Fkbp5 / 14229	MGIID:	104670	Length:	456	Species:	Mus musculus

Alignment Length:	88	Identity:	45/88 - (51%)
Similarity:	55/88 - (62%)	Gaps:	1/88 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 GDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGY 108
            ||.:.:||.|.| :||||||||.||.:||.|.||.|||||.||.|:..|..||...|...|:..|
Mouse    50 GDKVYVHYKGML-SDGKKFDSSHDRKKPFAFSLGQGQVIKAWDIGVSTMKKGEICHLLCKPEYAY 113

  Fly   109 GDQGAGNVIPPKATLLFDVELIN 131
            |..|....||..|||.|::||::
Mouse   114 GSAGHLQKIPSNATLFFEIELLD 136

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Fkbp14	NP_001246448.1	FKBP_C	37..130	CDD:278674	44/85 (52%)
		EF-hand_7	140..212	CDD:290234
		EFh	141..212	CDD:298682
Fkbp5	NP_034350.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..24
		FKBP_C	44..135	CDD:278674	44/85 (52%)
		TPR_11	267..347	CDD:290150
		TPR 1	268..301
		TPR repeat	268..296	CDD:276809
		TPR 2	317..350
		TPR_11	319..382	CDD:290150
		TPR	319..350	CDD:197478
		TPR repeat	319..345	CDD:276809
		TPR repeat	350..380	CDD:276809
		TPR 3	351..384
		TPR_1	352..384	CDD:278916
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	421..456
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0545
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810