DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdc and SDC4

DIOPT Version :9

Sequence 1:NP_001163238.2 Gene:Sdc / 37447 FlyBaseID:FBgn0010415 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_002990.2 Gene:SDC4 / 6385 HGNCID:10661 Length:198 Species:Homo sapiens


Alignment Length:165 Identity:50/165 - (30%)
Similarity:83/165 - (50%) Gaps:26/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 TGHIPTTDEIDVDGGDEDD---NGDSDID-------GPRIGGN----DGDITERGPGAGGSNV-- 390
            :|.:|..:::...|.:.||   :|..|:|       ||.:...    |..|.||  ...||.|  
Human    39 SGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPER--AGSGSQVPT 101

  Fly   391 --HELDPNTNVNSQPSDTKGIDHRPNGNEVVIMSEDDRTSSFFSQPGILAAVIGGAVVGLLCAIL 453
              .:|:.|..:   |.....::...:.:..|.||...:.|:.|.:..:|||:|.|.:||:|.|:.
Human   102 EPKKLEENEVI---PKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVF 163

  Fly   454 VVMFIVYRMRKKDEGSYALDEP---KRSPANNSYA 485
            :::.::|||:|||||||.|.:.   |::|.|..||
Human   164 LILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdcNP_001163238.2 Syndecan 429..493 CDD:279386 26/60 (43%)
SDC4NP_002990.2 Syndecan 139..196 CDD:307260 24/56 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142172
Domainoid 1 1.000 63 1.000 Domainoid score I10249
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507361at2759
OrthoFinder 1 1.000 - - FOG0003556
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10915
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4983
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.