DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdc and Sdc4

DIOPT Version :9

Sequence 1:NP_001163238.2 Gene:Sdc / 37447 FlyBaseID:FBgn0010415 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_036781.1 Gene:Sdc4 / 24771 RGDID:3650 Length:202 Species:Rattus norvegicus


Alignment Length:190 Identity:61/190 - (32%)
Similarity:86/190 - (45%) Gaps:41/190 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 DDEDDGD-DKDYDYNKELDKEIDIDGPEPGHLPPVVHHNTVETGHIPTTDEIDVDGGDEDDNGDS 364
            ||||.|. ::|.|:......::| |..||...|.|:........|||             :|...
  Rat    49 DDEDAGGLEQDSDFELSGSGDLD-DTEEPRTFPEVISPLVPLDNHIP-------------ENAQP 99

  Fly   365 DIDGPRIGGNDGDITERGPGAGGSNVHELDPNTNVNSQ-PSDTKGIDHRPNGNEVVIMSEDDRTS 428
            .|..|                  |...||:.|..:..: |||. |.|...|   .|.||...:.|
  Rat   100 GIRVP------------------SEPKELEENEVIPKRVPSDV-GDDDVSN---KVSMSSTSQGS 142

  Fly   429 SFFSQPGILAAVIGGAVVGLLCAILVVMFIVYRMRKKDEGSYALDEP---KRSPANNSYA 485
            :.|.:..:|||:|.|.|||:|.|:.:::.:||||:|||||||.|.:.   |::|.|..||
  Rat   143 NIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdcNP_001163238.2 Syndecan 429..493 CDD:279386 28/60 (47%)
Sdc4NP_036781.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..76 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..138 19/83 (23%)
Syndecan 143..200 CDD:279386 26/56 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335895
Domainoid 1 1.000 62 1.000 Domainoid score I10057
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507361at2759
OrthoFinder 1 1.000 - - FOG0003556
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10915
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.