DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdc and Sdc2

DIOPT Version :9

Sequence 1:NP_001163238.2 Gene:Sdc / 37447 FlyBaseID:FBgn0010415 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_032330.1 Gene:Sdc2 / 15529 MGIID:1349165 Length:202 Species:Mus musculus


Alignment Length:240 Identity:64/240 - (26%)
Similarity:96/240 - (40%) Gaps:52/240 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 TTTLAPTIPAEPQQPLFPPFDKDLDTESSGDGIDADAEDDDE-----DDGDDKDYDYNKELDKEI 321
            |..|...:.||.:..|....|..||..|..:.......|||:     ..|.|:|.:.......::
Mouse     9 TLGLMACVSAETRTELTSDKDMYLDNSSIEEASGVYPIDDDDYSSASGSGADEDIESPVLTTSQL 73

  Fly   322 DIDGPEPGHLPPVVHHNTVETGHIPTTDEIDVDGGDEDDNGDSDIDGPRIGGNDGDITER-GPGA 385
            ....|......|.|...|::|..|...   ..:..:|.|..:.||         .:..|: ||..
Mouse    74 IPRIPLTSAASPKVETMTLKTQSITPA---QTESPEETDKEEVDI---------SEAEEKLGPAI 126

  Fly   386 GGSNVHELDPNTNVNSQPSDTKGIDHRPNGNEVVIMSEDDRTSSFFSQPGILAAVIGGAVVGLLC 450
            ..::|:                               .:..:.:.|.:..:|||||.|.|:|.|.
Mouse   127 KSTDVY-------------------------------TEKHSDNLFKRTEVLAAVIAGGVIGFLF 160

  Fly   451 AILVVMFIVYRMRKKDEGSYALDEPKRSPANNSYAKNANNREFYA 495
            ||.:::.:||||||||||||.|.|  |.|::.:|.| |..:||||
Mouse   161 AIFLILLLVYRMRKKDEGSYDLGE--RKPSSAAYQK-APTKEFYA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdcNP_001163238.2 Syndecan 429..493 CDD:279386 31/63 (49%)
Sdc2NP_032330.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..63 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..118 7/41 (17%)
Syndecan 139..200 CDD:279386 31/63 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..202 11/25 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832230
Domainoid 1 1.000 62 1.000 Domainoid score I10268
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4993
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003556
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10915
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4983
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.