DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-d and Acads

DIOPT Version :9

Sequence 1:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_071957.1 Gene:Acads / 64304 RGDID:620514 Length:414 Species:Rattus norvegicus


Alignment Length:402 Identity:88/402 - (21%)
Similarity:156/402 - (38%) Gaps:72/402 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 STVKKVAEAAVKLKALQNKLNPGGTDIWPGGLFNAQSFGLFPANHPIAT-------HITMFVDVI 131
            |.|||:.|..:....:..:|:..|.|      :.|.|..|...:...|:       :.::::..|
  Rat    71 SQVKKMGELGLLAMDVPEELSGAGLD------YLAYSIALEEISRGCASTGVIMSVNNSLYLGPI 129

  Fly   132 KGQGTAEQVEKWGKAAENCNIIGTYAQTELAHGTNVRGLATRADFDPKTDEFVLNTPNLEAYKWW 196
            ...|:::|.::|.....|.:.||.:|.:|..:|::....:|.|  ..:.|.:|||.........|
  Rat   130 LKFGSSQQKQQWITPFTNGDKIGCFALSEPGNGSDAGAASTTA--REEGDSWVLNGTKAWITNSW 192

  Fly   197 PGGLGHTANHAMVVAQLYIADVHHGVQMFIVPLRDSETHMPLPGVDIGEIGKKLGMASVNQGFLG 261
                  .|:..:|.|....:..:.|:..|:||       ||.||:.:|:...|||:.:.:...|.
  Rat   193 ------EASATVVFASTDRSRQNKGISAFLVP-------MPTPGLTLGKKEDKLGIRASSTANLI 244

  Fly   262 LNHVRIPRTNML----MKFAKVERDGTFKASPASRINYLTMVYTRCLIVSQNSTLLLAAATIATR 322
            ....|||:.|:|    |.|               :|...|:...|..|.||...:..|:...|.:
  Rat   245 FEDCRIPKENLLGEPGMGF---------------KIAMQTLDMGRIGIASQALGIAQASLDCAVK 294

  Fly   323 YSAVRRQ--SPIEPNQPEPQIIDHVTQRLKLFPEIATGIAYHLATEYMWEMYAQTVQEANNGKFE 385
            |:..|..  :|:...|         ..:.|| .::|  :|...|....|.   ..:.:.|...|.
  Rat   295 YAENRHAFGAPLTKLQ---------NIQFKL-ADMA--LALESARLLTWR---AAMLKDNKKPFT 344

  Fly   386 RLPDMHILSCALKVLCTTDGCAGIEKLRLS-TGGHGYLIAANLSNIYGNAVAAYTYEGENTVLLL 449
            :       ..|:..|..::....|....:. .||.||:........|.:|.....|||.:.:..|
  Rat   345 K-------ESAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERYYRDARITEIYEGTSEIQRL 402

  Fly   450 QIGRALVKAWAS 461
            .|...|::::.|
  Rat   403 VIAGHLLRSYRS 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 88/402 (22%)
PLN02443 16..677 CDD:178062 88/402 (22%)
AcadsNP_071957.1 CaiA 35..414 CDD:224871 87/400 (22%)
SCAD_SBCAD 38..410 CDD:173847 87/396 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.