DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-d and ivd

DIOPT Version :9

Sequence 1:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_001011380.1 Gene:ivd / 496848 XenbaseID:XB-GENE-1008677 Length:419 Species:Xenopus tropicalis


Alignment Length:446 Identity:94/446 - (21%)
Similarity:152/446 - (34%) Gaps:124/446 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EFSAWWHGGQDKLKKKREI-EKAIFSDLEDGYGLNHEYMSH----EEVYNSTVKKVAEAAVKLKA 88
            |..::|       ||..|: ...|.:.:|.| |....|:.|    ||:..      |.|||.|  
 Frog    72 EMRSFW-------KKLGELGVLGITAPVEYG-GSAMGYLEHVLVVEEISR------ASAAVGL-- 120

  Fly    89 LQNKLNPGGTDIWPGGLFNAQSFGLFPANHPIATHITMFVDVIKGQGTAEQVEKWGKAAENCNII 153
                                 |:|         .|..:.::.|...|...|.||:.....:...|
 Frog   121 ---------------------SYG---------AHSNLCINQIVRNGNEAQKEKYLPKLISGEYI 155

  Fly   154 GTYAQTELAHGTNVRGLATRADFDPKTDEFVLNTPNLEAYKWWPGGLGHTANHAMVVAQLYI--- 215
            |..|.:|...|::|..:..:|  :.|.|.:|||     ..|:|... |..|:    |..:|:   
 Frog   156 GALAMSEPNSGSDVVSMRLKA--EKKGDYYVLN-----GNKFWITN-GPDAD----VLVVYVKTD 208

  Fly   216 ---ADVHHGVQMFIVPLRDSETHMPLPGVDIGEIGKKLGMASVNQGFLGLNHVRIPRTNMLMKFA 277
               ....||:..|:|       ...:||....:...||||...|...|.....:||..|:|....
 Frog   209 PSAQPASHGITAFLV-------EKGMPGFSTAQKLDKLGMRGSNTCELVFEDCKIPEQNVLGHLG 266

  Fly   278 KVERDGTFKASPASRINYLTMVYTRCLIVS--QNSTLLLAAATIATRYSAVRRQSP-IEPNQPEP 339
            |    |.:                  :::|  ....|:|:...:....:.:....| :...:...
 Frog   267 K----GVY------------------VLMSGLDLERLVLSGGPLGIMQAVLDHAIPYLHTREAFG 309

  Fly   340 QIIDHVTQRLKLFPEIATGIAYHLATEYMWEMYAQTVQEANNGKFERLPDMHILSCALKVLCTTD 404
            |.|.|.........::.|.:|  ...:|::.:.....|...|.|          .||..:|.:.:
 Frog   310 QKIGHFQLMQGKMADMYTRLA--ACRQYVYNVAKACDQGHFNSK----------DCAGVILYSAE 362

  Fly   405 GCA------GIEKLRLSTGGHGYLIAANLSNIYGNAVAAYTYEGENTVLLLQIGRA 454
             ||      ||:.|    ||:||:....:.....:|.......|.:.|..:.||||
 Frog   363 -CATQVALDGIQCL----GGNGYINDYPMGRFLRDAKLYEIGAGTSEVRRMLIGRA 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 94/446 (21%)
PLN02443 16..677 CDD:178062 94/446 (21%)
ivdNP_001011380.1 IVD 37..416 CDD:173845 94/446 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.