DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-d and gcdhb

DIOPT Version :9

Sequence 1:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_001006024.1 Gene:gcdhb / 450003 ZFINID:ZDB-GENE-041010-117 Length:427 Species:Danio rerio


Alignment Length:356 Identity:72/356 - (20%)
Similarity:125/356 - (35%) Gaps:119/356 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 HPIATHITMFVDVIKGQGTAEQVEKWGKAAENCNIIGTYAQTELAHGTNVRGLATRADFDPKTDE 182
            |||..:           ||.||.:|:........|:|.:..||..||::...:.|:|.::..:..
Zfish   152 HPINAY-----------GTEEQKQKYLPRLAQGEILGCFGLTEPNHGSDPGSMETKAKYNSSSHT 205

  Fly   183 FVLNTPNLEAYKWWPGGLGHTANHAMVVAQLYIADV-------HHG-VQMFIVPLRDSETHMPLP 239
            |.|.     ..|.|             :....:||:       ..| |:.||:       ...:.
Zfish   206 FTLT-----GSKTW-------------ITNSPVADICVVWAKCEDGKVRGFIL-------ERGMK 245

  Fly   240 GVDIGEIGKKLGMASVNQGFLGLNHVRIPRTNMLMKFAKVERDGTFKASPASRINYLTMVYTRCL 304
            |:...:|..|..:.:...|.:.::.|.:|..|:|.|.:.:       |.|...:|          
Zfish   246 GLSTPKIEGKFSLRASATGMIIMDEVEVPEENLLPKASGL-------AGPFGCLN---------- 293

  Fly   305 IVSQNSTLLLAAATI---------ATRYSAVRRQ--SPIEPNQ-PEPQIIDHVTQRLKLFPEIAT 357
                |:...:|...:         |.:|:..|.|  .|:..|| .:.::.|.:|       ||..
Zfish   294 ----NARYGIAWGALGAAEFCFHAARQYTLDRIQFGVPLARNQLMQKKMADMLT-------EITL 347

  Fly   358 GIAYHLATEYMWEMYAQTVQEANNGKFERLPDMHIL----SC--ALKVLCTTDGCAGIEKLRLST 416
            |:...|       ...:.:.:.     :..|:|..|    ||  ||.:         ..:.|...
Zfish   348 GLQSCL-------QLGRLIDDK-----KAAPEMISLLKRNSCGKALDI---------ARQARDML 391

  Fly   417 GGHG----YLIAANLSNIYGNAVAAYTYEGE 443
            ||:|    |.|..::.|:    .|..||||:
Zfish   392 GGNGIADEYHIIRHVLNL----EAVNTYEGQ 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 72/356 (20%)
PLN02443 16..677 CDD:178062 72/356 (20%)
gcdhbNP_001006024.1 GCD 50..418 CDD:173840 71/354 (20%)
CaiA 62..426 CDD:224871 72/356 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.