DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-d and Arc42

DIOPT Version :9

Sequence 1:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_650840.1 Gene:Arc42 / 42364 FlyBaseID:FBgn0038742 Length:405 Species:Drosophila melanogaster


Alignment Length:412 Identity:93/412 - (22%)
Similarity:151/412 - (36%) Gaps:67/412 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NHEYMSHEEVY-NSTVKKVAEAAVKLKALQNKLNPGGTDIWPGGLFNAQ-SFGLFPANHPIATHI 124
            |......|.:| ...::::.|..|...|:..:|...|.|.....:...: |.|...|...::.:.
  Fly    49 NAAKFDREHLYPEKQIRQMGELGVMAVAIPEELGGTGLDYVAYAIAMEEISRGCASAGVIMSVNN 113

  Fly   125 TMFVDVIKGQGTAEQVEKWGKAAENCNIIGTYAQTELAHGTNVRGLATRADFDPKTDEFVLNTPN 189
            ::::..:...|...|.:.:.........:|.:|.:|..:|::....:|.|  ..|.|.||||   
  Fly   114 SLYLGPLLSFGNDAQKKDYITPFTTGERVGCFALSEPGNGSDAGAASTIA--TDKGDHFVLN--- 173

  Fly   190 LEAYKWWPGGLGHTANHAMVVAQLYIADVHHGVQMFIVPLRDSETHMPLPGVDIGEIGKKLGMAS 254
              ..|.|... ...|..|:|.|.......|.|:..||||       ....|..:|:...|||:..
  Fly   174 --GTKAWITN-AFEAEAAIVFATTNKQLKHKGISAFIVP-------KATKGFSLGKKEDKLGIRG 228

  Fly   255 VNQGFLGLNHVRIPRTNML------MKFAKVERDGTFKASPASRINYLTMVYTRCLIVSQNSTLL 313
            .:...|......:|:.|||      .|.|....|       |.||.          |..|...:.
  Fly   229 SSTCQLIFEDCVVPKENMLGEPGFGFKIAMQTLD-------AGRIG----------IAGQALGIG 276

  Fly   314 LAAATIATRYSAVRRQS---PIEPNQP-EPQIIDHVTQRLKLFPEIATGIAYHLATEYMWEMYAQ 374
            .||..:|..| |.:||:   ||...|. :.:|.|     :.|..|.|..:.:..|  ::.:....
  Fly   277 QAALELAVDY-AQKRQAFGKPIAKLQSIQQKIAD-----MSLAMESARLLTWRAA--WLKDQKQP 333

  Fly   375 TVQEANNGKFERLPDMHILSCALKVLCTTDGCAGIEKLRLSTGGHGYLIAANLSNIYGNAVAAYT 439
            ..:||...|        :.:.....||:.. |..|      .||.||:........|.:|.....
  Fly   334 YTKEAAMAK--------LAASEAATLCSHQ-CIQI------LGGMGYVTDMAAERHYRDARITEI 383

  Fly   440 YEGENTVLLLQIGRALVKAWAS 461
            |||.:.:..|.|..:::|.:||
  Fly   384 YEGTSEIQRLVIAGSILKEYAS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 93/412 (23%)
PLN02443 16..677 CDD:178062 93/412 (23%)
Arc42NP_650840.1 CaiA 27..405 CDD:224871 91/410 (22%)
SCAD_SBCAD 29..401 CDD:173847 90/406 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460769
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.