DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-d and CG4860

DIOPT Version :9

Sequence 1:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster


Alignment Length:404 Identity:88/404 - (21%)
Similarity:153/404 - (37%) Gaps:74/404 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EEVYNS-TVKKVAEAAVKLKALQNKLNPGGTDIWPGGLFNAQSFGLFP-ANHPIATHITM----- 126
            ||:|.: .|:::.|..:....::.:....|.|      :.|.:.|:.. |....|..|.|     
  Fly    66 EELYPAEQVRRLGELGLMSVTVREEYGGSGLD------YQAYAIGMEEVARGDAAVSIVMGVNNL 124

  Fly   127 FVDVIKGQGTAEQVEKWGKAAENCNIIGTYAQTELAHGTNVRGLATRADFDPKTDEFVLNTPNLE 191
            ::..::..||.:|.:.:.........|..||.:|..:|::....:|.|..  :.|.:.:|     
  Fly   125 YLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDAGAASTTAKL--QGDSYQIN----- 182

  Fly   192 AYKWWPGGLGHTANHAMVVAQLYIADVHHGVQMFIVPLRDSETHMPLPGVDIGEIGKKLGMASVN 256
            ..|.|... ...|:..:|.|.:..:..|.|:..|:.| :|      :||:.|.:...|:||.:.:
  Fly   183 GTKAWISN-SKEASGGIVFATVDKSMKHKGITAFLTP-KD------VPGLSIAKKESKMGMRATS 239

  Fly   257 QGFLGLNHVRIPRTNMLMKFAKVERDGTFKASPAS----RINYLTMVYTRCLIVSQNSTLLLAAA 317
            ...|.|..|.:||:.:|    ....|| ||.:..|    ||.          |.:|.:.:..||.
  Fly   240 TCQLVLEDVHVPRSRVL----GAAGDG-FKIAMQSLDCGRIG----------IAAQATGIAQAAL 289

  Fly   318 TIATRYSAVRRQSPIEPNQPEPQIIDHVTQRLKLFPEIATGIAYHLATEYMWEMYAQTVQEANNG 382
            .:|..||           |.......|:. ||:|..:....:|..:....:....|..:::  ||
  Fly   290 ELAVDYS-----------QKRVAFGKHLA-RLQLIQQKLADMATRVEISRLLTWRAAWLKD--NG 340

  Fly   383 ----KFERLPDMHILSCALKVLCTTDGCAGIEKLRLSTGGHGYLIAANLSNIYGNAVAAYTYEGE 443
                |...:..:|....|  ..|... |..|      .||.||.........|.||.....|||.
  Fly   341 LPITKEAAMAKLHASESA--TFCAHQ-CIQI------LGGMGYTTDLPAELYYRNARVTEIYEGT 396

  Fly   444 NTVLLLQIGRALVK 457
            :.:..:.|..|:::
  Fly   397 SEIQRIVIANAVLR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 88/404 (22%)
PLN02443 16..677 CDD:178062 88/404 (22%)
CG4860NP_650163.2 CaiA 37..414 CDD:224871 88/404 (22%)
SCAD_SBCAD 39..410 CDD:173847 88/402 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460773
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.