DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-d and CG3902

DIOPT Version :9

Sequence 1:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster


Alignment Length:393 Identity:90/393 - (22%)
Similarity:141/393 - (35%) Gaps:106/393 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EEVYNSTVKKVA----EAAVKLKALQNKLNPGGTD-IWPGGLFNAQ-------SFGLFPAN---- 117
            |::...||.|:|    :..||....::|.:|.... ::..||...:       |...|..|    
  Fly    41 EKMMKETVAKLAQEQIQPLVKKMDFEHKFDPSVVKAVFENGLMGIEIDTELGGSGCNFMTNIVVV 105

  Fly   118 ---HPIATHITMFVDV---------IKGQGTAEQVEKW-GKAAENCNIIGTYAQTELAHGTNVRG 169
               ..|...:..|||:         || .|.|||..|: .|.|:  ...|::|.||...|::...
  Fly   106 EELSKIDPAVAAFVDIHNTLVNSLMIK-FGNAEQKAKYLPKLAQ--EYAGSFALTEPGAGSDAFS 167

  Fly   170 LATRADFDPKTDEFVLNTPNLEAYKWWPGGLGHTANHAMVVAQLYIADVHHGVQMFIVPLRDSET 234
            |.|.|..|  ...:|:|     ..|.|... ...|...::.|.....|.:.|:..|||   |.||
  Fly   168 LKTVAKKD--GSHYVIN-----GSKMWISN-SDVAGVFLIFANAKPEDGYRGITTFIV---DRET 221

  Fly   235 HMPLPGVDIGEIGKKLGMASVNQGFLGLNHVRIPRTNMLMKFAKVER------------------ 281
                ||:.:.:...|||:.:.....|..::||:|..|:|..|....:                  
  Fly   222 ----PGLIVNKPEDKLGIRASGTCQLTFDNVRVPEENILGTFGHGYKYAAGFLNEGRIGIAAQMV 282

  Fly   282 ---DGTFKASPASRINYL-------TMVYTRCLIVSQNSTLL--LAAATIATRYSAVRRQSPIEP 334
               .|||.|:    |.||       ..:|....:..|.:|:.  :.||.:.| |:|.|.|....|
  Fly   283 GLAQGTFDAT----IPYLLERKQFGDAIYNFQSMQHQIATVATEIEAARLMT-YNAARLQEQGVP 342

  Fly   335 NQPEPQIIDH----VTQRL--------------------KLFPEIATGIAYHLATEYMWEMYAQT 375
            .|.|..:..:    |.||.                    |.:.::..|..|...|.......|:.
  Fly   343 FQKEAAMAKYYASEVAQRAAIKCVDWMGGVGFTRDFPQEKYYRDVKIGAIYEGTTNMQLSTIAKC 407

  Fly   376 VQE 378
            :::
  Fly   408 IKK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 90/393 (23%)
PLN02443 16..677 CDD:178062 90/393 (23%)
CG3902NP_649069.2 CaiA 37..414 CDD:224871 90/393 (23%)
SCAD_SBCAD 39..410 CDD:173847 90/391 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460759
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.