DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-d and CG9547

DIOPT Version :9

Sequence 1:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster


Alignment Length:373 Identity:81/373 - (21%)
Similarity:138/373 - (36%) Gaps:120/373 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IATHITMFVDVIKGQGTAEQVEKWGKAAENCNIIGTYAQTELAHGTNVRGLATRADFDPKTDEFV 184
            ::...::.:..|...|:.||.:::..:.....:||.:..||..||::..|:.|||.:|.|:..::
  Fly   122 VSVQSSLAMGAIYDFGSEEQKQRYLPSMAEGKLIGAFGLTEPNHGSDPAGMETRAKYDSKSKTYI 186

  Fly   185 LNTPNLEAYKWWPGGLGHTANHAMVVAQLYIADV-------HHG-VQMFIVPLRDSETHMPLPGV 241
            ||     ..|.|             :....||||       ..| |:.|:|..:.|.     .|:
  Fly   187 LN-----GSKTW-------------ITSAPIADVIVVWAKCEDGKVRGFLVDRKISG-----KGL 228

  Fly   242 DIGEIGKKLGMASVNQGFLGLNHVRIPRTNMLMKFAKVERDGTFKASPASRINYLTMVYTRCLIV 306
            :..:|..|..:.:...|.:.::.||:|...:|...|..       :.|.|.:|            
  Fly   229 ETPKIEGKFSLRASPTGMILMDEVRVPEEQLLPNVAGF-------SGPFSCLN------------ 274

  Fly   307 SQNST------LLLAAAT---IATRYSAVRRQ--SPIEPNQ-PEPQIIDHVTQRLKLFPEIATGI 359
              |:.      .|.||.|   ||.:|:..|:|  .|:..|| .:.::.|.:|       |||.|:
  Fly   275 --NARYGIAWGALGAAETCVEIARQYTLDRKQFGRPLAANQLIQKKLADAIT-------EIALGL 330

  Fly   360 AYHLATEYMWEMYAQTVQEANNGKFERL--PDMHILSCALKVLCTTDGCAGIEKLRLSTGGHGYL 422
                          |........|.::|  |||                  |..|:.:..|....
  Fly   331 --------------QACLHVGRLKDQKLHTPDM------------------ISLLKRNNTGKSLD 363

  Fly   423 IAANLSNIYG---------------NAVAAYTYEGENTVLLLQIGRAL 455
            ||..:.::.|               |..:..||||.:.:..|.:|||:
  Fly   364 IARQMRDMLGANGISDEYHVIRHVINLESVNTYEGTHDIHALILGRAI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 81/373 (22%)
PLN02443 16..677 CDD:178062 81/373 (22%)
CG9547NP_609040.1 GCD 29..417 CDD:173840 81/373 (22%)
CaiA 41..417 CDD:224871 81/373 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460782
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.