DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-d and ACAD8

DIOPT Version :9

Sequence 1:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster
Sequence 2:XP_024304205.1 Gene:ACAD8 / 27034 HGNCID:87 Length:493 Species:Homo sapiens


Alignment Length:452 Identity:90/452 - (19%)
Similarity:148/452 - (32%) Gaps:149/452 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KAIFSDLEDGYGLNHEYMSHEEV-YNSTVKKVA------------EAAVKLKALQNKLNPGG--- 97
            :::.|.::...|||.|....::| ::...:::|            ...|..||.|  |..||   
Human    29 RSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQ--LGFGGVYI 91

  Fly    98 -TDIWPGGLFNAQSFGLFPANHPIATHITMFVDV-------IKGQGTAEQVEKWGKAAENCNIIG 154
             ||:...||....:..:|.|.....|..|.::.:       |...|..||..|:...........
Human    92 QTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFA 156

  Fly   155 TYAQTELAHGTNVRGLATRADFDPKTDEFVLNTPNLEAYKWWPGGLGHTANHAMVVAQLYIADVH 219
            :|..||...|::...|.|.|  ..:.|.::||     ..|.:..|.|.        :.:|:....
Human   157 SYCLTEPGSGSDAASLLTSA--KKQGDHYILN-----GSKAFISGAGE--------SDIYVVMCR 206

  Fly   220 ------HGVQMFIVPLRDSETHMPLPGVDIGEIGKKLG---------------------MASVNQ 257
                  .|:...:|       ....||:..|:..||:|                     :.|..|
Human   207 TGGPGPKGISCIVV-------EKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQ 264

  Fly   258 GFL----GLNHVRIPRTNMLMKFAKVERDGTFKASPASRINYLTMVYTRCLIVSQNSTLLLAAAT 318
            |||    |||                          ..|||..:     |.:.:.:::::|    
Human   265 GFLIAVRGLN--------------------------GGRINIAS-----CSLGAAHASVIL---- 294

  Fly   319 IATR-YSAVRRQ--SPIEPNQPEPQIIDHVTQRLKLFPEIATGIAYHLATEYMWEMYAQTVQEAN 380
              || :..||:|  .|:..||.....:..:..||             :|...|....|..:||..
Human   295 --TRDHLNVRKQFGEPLASNQYLQFTLADMATRL-------------VAARLMVRNAAVALQEER 344

  Fly   381 NGKFERLPDMHILSCALKVLCTTDGCAGIEKLRLSTG-------GHGYLIAANLSNIYGNAV 435
            ...        :..|::..|..||.|..:.....|.|       |.|.|  .::|.|:..|:
Human   345 KDA--------VALCSMAKLFATDECFAVSDSSGSPGMDREQLLGPGVL--RDMSQIWNPAL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 90/452 (20%)
PLN02443 16..677 CDD:178062 90/452 (20%)
ACAD8XP_024304205.1 IBD 41..387 CDD:173851 85/429 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.