DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-d and Gcdh

DIOPT Version :9

Sequence 1:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_001038209.2 Gene:Gcdh / 270076 MGIID:104541 Length:447 Species:Mus musculus


Alignment Length:380 Identity:83/380 - (21%)
Similarity:133/380 - (35%) Gaps:123/380 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 HPIATHITMFVDVIKGQGTAEQVEKWGKAAENCNIIGTYAQTELAHGTNVRGLATRADFDPKTDE 182
            |||.|:           |:.||.:|:........::|.:..||..||::..|:.|||..:|....
Mouse   159 HPIYTY-----------GSEEQRQKYLPGLAKGELLGCFGLTEPNHGSDPGGMETRARHNPSNQS 212

  Fly   183 FVLNTPNLEAYKWWPGGLGHTANHAMVVAQLYIADVHHGVQMFIVPLRDSET-------HMPLPG 240
            :.|:     ..|.|             :....:||      :|||..|..:.       ...:.|
Mouse   213 YTLS-----GTKTW-------------ITNSPVAD------LFIVWARCEDNCIRGFILEKGMRG 253

  Fly   241 VDIGEIGKKLGMASVNQGFLGLNHVRIPRTNMLMKFAKVERDGTFKASPASRINYLTMVYTRCLI 305
            :....|..|..:.:...|.:.::.|.:|..|:|...:.:       |.|..           ||.
Mouse   254 LSAPRIEGKFSLRASATGMIIMDSVEVPEENVLPNVSSL-------AGPFG-----------CLN 300

  Fly   306 VSQNSTL--LLAAATI----ATRYSAVRRQ--SPIEPNQ-PEPQIIDHVTQRLKLFPEIATGIAY 361
            .::....  :|.||..    |.:|:..|.|  .|:..|| .:.::.|.:|       ||..|:..
Mouse   301 TARYGITWGVLGAAEFCLHTARQYALDRIQFGVPLARNQLVQKKLADMLT-------EITLGLHA 358

  Fly   362 HL----------ATEYMWEMYAQTVQEANNGKFERLPDMHILSCALKVLCTTDGCAGIEKLRLST 416
            .|          ||..|..|    ::..|.||            ||.:         ..:.|...
Mouse   359 CLQLGRLKDQDKATPEMVSM----LKRNNCGK------------ALDI---------ARQARDIL 398

  Fly   417 GGHGYLIAANLSNIYG------NAVAAYTYEGENTVLLLQIGRALVKAWASFVDK 465
            ||:|      :|:.|.      |..|..||||.:.:..|.:|||:....|..|.|
Mouse   399 GGNG------ISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITGIQAFTVGK 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 83/380 (22%)
PLN02443 16..677 CDD:178062 83/380 (22%)
GcdhNP_001038209.2 GCD 57..443 CDD:173840 80/374 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.