DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-d and GCDH

DIOPT Version :9

Sequence 1:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_000150.1 Gene:GCDH / 2639 HGNCID:4189 Length:438 Species:Homo sapiens


Alignment Length:363 Identity:73/363 - (20%)
Similarity:126/363 - (34%) Gaps:109/363 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 HPIATHITMFVDVIKGQGTAEQVEKWGKAAENCNIIGTYAQTELAHGTNVRGLATRADFDPKTDE 182
            |||..:           |:.||.:|:........::|.:..||...|::...:.|||.::.....
Human   150 HPIYAY-----------GSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRAHYNSSNKS 203

  Fly   183 FVLNTPNLEAYKWWPGGLGHTANHAMVVAQLYI--ADVHHG-VQMFIVPLRDSETHMPLPGVDIG 244
            :.||     ..|.|      ..|..|  |.|::  |....| ::.|::       ...:.|:...
Human   204 YTLN-----GTKTW------ITNSPM--ADLFVVWARCEDGCIRGFLL-------EKGMRGLSAP 248

  Fly   245 EIGKKLGMASVNQGFLGLNHVRIPRTNMLMKFAKVERDGTFKASPASRINYLTMVYTRCLIVSQN 309
            .|..|..:.:...|.:.::.|.:|..|:|...:.:  .|.|                .||   .|
Human   249 RIQGKFSLRASATGMIIMDGVEVPEENVLPGASSL--GGPF----------------GCL---NN 292

  Fly   310 STLLLAAATI---------ATRYSAVRRQ--SPIEPNQ-PEPQIIDHVTQRLKLFPEIATGIAYH 362
            :...:|...:         |.:|:..|.|  .|:..|| .:.::.|.:|       ||..|:  |
Human   293 ARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLT-------EITLGL--H 348

  Fly   363 LATEYMWEMYAQTVQEANNGKFERLPDMHILSCALKVLCTTDGCAG----IEKLRLSTGGHGYLI 423
            ...:                 ..||.|....:..:..|...:.|..    ..:.|...||:|   
Human   349 ACLQ-----------------LGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNG--- 393

  Fly   424 AANLSNIYG------NAVAAYTYEGENTVLLLQIGRAL 455
               :|:.|.      |..|..||||.:.:..|.:|||:
Human   394 ---ISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAI 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 73/363 (20%)
PLN02443 16..677 CDD:178062 73/363 (20%)
GCDHNP_000150.1 GCD 48..434 CDD:173840 73/363 (20%)
Substrate binding 138..139
Substrate binding 287..294 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.